PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vradi07g26830.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family TALE
Protein Properties Length: 247aa    MW: 27904.4 Da    PI: 5.2222
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vradi07g26830.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.41.4e-091752092155
                      HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
         Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                      k +yps++++  LA+++gL+++q+ +WF N+R ++
  Vradi07g26830.1 175 KWPYPSESQKLALAESTGLDQKQINNWFINQRKRH 209
                      569*****************************885 PP

2ELK38.91.9e-13129149121
              ELK   1 ELKhqLlrKYsgyLgsLkqEF 21 
                      ELK qLlrKY+gyLgsLkqEF
  Vradi07g26830.1 129 ELKGQLLRKYRGYLGSLKQEF 149
                      9*******************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012561.5E-234798IPR005541KNOX2
PfamPF037917.6E-215197IPR005541KNOX2
SMARTSM011885.9E-7129150IPR005539ELK domain
PfamPF037893.4E-9129149IPR005539ELK domain
PROSITE profilePS5121311.139129149IPR005539ELK domain
PROSITE profilePS5007113.07149212IPR001356Homeobox domain
SMARTSM003897.4E-13151216IPR001356Homeobox domain
SuperFamilySSF466895.99E-20151227IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.9E-28154214IPR009057Homeodomain-like
CDDcd000862.48E-12161213No hitNo description
PfamPF059203.7E-17169208IPR008422Homeobox KN domain
PROSITE patternPS000270187210IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009934Biological Processregulation of meristem structural organization
GO:0048440Biological Processcarpel development
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 247 aa     Download sequence    Send to blast
MEGGSNEASS VMGFGENTSS SGVGAPPEVV ARLEEACASS AVTMAGGTAR IGEDPALDQF  60
MEAYCEMLIK YEQELSKPFK DAMLFLQRIE CQFKSLTISS SDTDGGRNGT SEEIDVENNI  120
IDPQAEEQEL KGQLLRKYRG YLGSLKQEFT KKRKKGKLPK EARQQLLDWW SRHYKWPYPS  180
ESQKLALAES TGLDQKQINN WFINQRKRHW KPSEDMQFVV VDPSHPHYYM ENVLANPFPD  240
LSHTML*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1144153LKQEFTKKRK
2150154KKRKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ8573391e-152DQ857339.1 Glycine max KNT1 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014509083.11e-170PREDICTED: homeobox protein SBH1
SwissprotP466081e-129HSBH1_SOYBN; Homeobox protein SBH1
TrEMBLA0A0L9TT001e-154A0A0L9TT00_PHAAN; Uncharacterized protein
TrEMBLA0A0S3R9P21e-153A0A0S3R9P2_PHAAN; Uncharacterized protein
STRINGGLYMA07G39350.11e-140(Glycine max)
STRINGGLYMA17G01370.21e-141(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20393480
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62360.11e-112KNOX/ELK homeobox transcription factor